General Information

  • ID:  hor001859
  • Uniprot ID:  P81278
  • Protein name:  Prolactin-releasing peptide PrRP31
  • Gene name:  Prlh
  • Organism:  Rattus norvegicus (Rat)
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  Widely expressed, with highest levels in medulla oblongata and hypothalamus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005148 prolactin receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031861 prolactin-releasing peptide receptor binding
  • GO BP:  GO:0001894 tissue homeostasis; GO:0002021 response to dietary excess; GO:0002023 reduction of food intake in response to dietary excess; GO:0006112 energy reserve metabolic process; GO:0006629 lipid metabolic process; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007631 feeding behavior; GO:0009749 response to glucose; GO:0032868 response to insulin; GO:0040014 regulation of multicellular organism growth; GO:0042755 eating behavior; GO:0043434 response to peptide hormone; GO:0045444 fat cell differentiation; GO:0048483 autonomic nervous system development
  • GO CC:  GO:0005576 extracellular region; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  SRAHQHSMETRTPDINPAWYTGRGIRPVGRF
  • Length:  31
  • Propeptide:  MALKTWLLCLLLLSLVLPGASSRAHQHSMETRTPDINPAWYTGRGIRPVGRFGRRRATPRDVTGLGQLSCLPLDGRTKFSQRG
  • Signal peptide:  MALKTWLLCLLLLSLVLPGAS
  • Modification:  T31 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates prolactin (PRL) release and regulates the expression of prolactin
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Prlhr
  • Target Unid:  Q64121
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P81278-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001859_AF2.pdbhor001859_ESM.pdb

Physical Information

Mass: 413028 Formula: C156H241N53O44S
Absent amino acids: CKL Common amino acids: R
pI: 11.91 Basic residues: 7
Polar residues: 10 Hydrophobic residues: 7
Hydrophobicity: -107.42 Boman Index: -9830
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 40.97
Instability Index: 1473.55 Extinction Coefficient cystines: 6990
Absorbance 280nm: 233

Literature

  • PubMed ID:  NA
  • Title:  A prolactin-releasing peptide in the brain.